PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00951.1_g00017.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 535aa    MW: 60203.2 Da    PI: 4.3067
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00951.1_g00017.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.44.1e-51181461128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              l+pGfrFhPtdeelv +yLk+k+ +k++++ ++i+ +++yk+ePwdLp + k+k+++ ewyfFs  d+ky++g+++nrat++gyWk
  Rsa1.0_00951.1_g00017.1  18 LAPGFRFHPTDEELVRYYLKRKICNKPFRF-DAISVTHVYKSEPWDLPsQsKLKSRDLEWYFFSVLDNKYSNGSKTNRATEKGYWK 102
                              579**************************9.99**************95247777888**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              +tgkd+e+ + ++ +vg+kktLv++kgrap+ge+++Wvmheyrl
  Rsa1.0_00951.1_g00017.1 103 TTGKDREIRNGSRVVVGMKKTLVYHKGRAPRGERSNWVMHEYRL 146
                              **********99999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-5913169IPR003441NAC domain
PROSITE profilePS5100556.03818169IPR003441NAC domain
PfamPF023651.7E-2720146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009819Biological Processdrought recovery
GO:0010150Biological Processleaf senescence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 535 aa     Download sequence    Send to blast
MGRGGGGSSS SSSETSSLAP GFRFHPTDEE LVRYYLKRKI CNKPFRFDAI SVTHVYKSEP  60
WDLPSQSKLK SRDLEWYFFS VLDNKYSNGS KTNRATEKGY WKTTGKDREI RNGSRVVVGM  120
KKTLVYHKGR APRGERSNWV MHEYRLVDDE IVKAGVQKDA YVVCKIFQKS GSGPKNGEQY  180
GAPFVEEEWE EEDGMTFVPN QDLEDQVYVD VNDNDIDQKL DVYDAIPIHL GFDHGESSNN  240
VETNYSDSTN YIEPGNYGYF EGPMEKHIIH DGSSLQNEEN GCGVQEESRA NLQSSDNIFD  300
ADASLYNDFP VESNYFTGEE FLDQNSSLLQ NDGLYLDAND LDNTQEDGFN FEDYLTFFDE  360
DDQNLTFDPS QLMGTEDNIP DQEELFQMAE TEAASGGKQV VEEASCSKQV HADATEFEPD  420
YKDTFIKKAS HMIGAIPSPT IFSSEILTKD GVVRLQAGQP SGSVHVSMIT ISDSNMDWSY  480
GKNGNLDLLL SFGLVQENVS GKSENHLTRV MLIFVCFWVL LLSVSFKVST LVSSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A7e-431717519174NAC domain-containing protein 19
3swm_B7e-431717519174NAC domain-containing protein 19
3swm_C7e-431717519174NAC domain-containing protein 19
3swm_D7e-431717519174NAC domain-containing protein 19
3swp_A7e-431717519174NAC domain-containing protein 19
3swp_B7e-431717519174NAC domain-containing protein 19
3swp_C7e-431717519174NAC domain-containing protein 19
3swp_D7e-431717519174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00343DAPTransfer from AT3G10500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013640885.10.0PREDICTED: NAC domain-containing protein 53-like
SwissprotQ949N00.0NAC53_ARATH; NAC domain-containing protein 53
TrEMBLA0A078HVH30.0A0A078HVH3_BRANA; BnaA01g31650D protein
STRINGBra034120.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.10.0NAC domain containing protein 53